PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013634737.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 266aa    MW: 28830.6 Da    PI: 8.79
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013634737.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.33e-3953151199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l++el 
  XP_013634737.1  53 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQSLQSELT 147
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_013634737.1 148 AVRT 151
                     9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.14252153IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-4053150IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSRDSREGFG DYYKIVKKVK KDPTFEKTMD HAVMGIRRHV AVPPGTTLNT VTPCAACKLL  60
RRRCAEECPF SPYFSPHEPH KFAAVHKVFG ASNVSKMLLE VGESQRGDAA NSLVYEANLR  120
LRDPIYGCMG AISALQHHIQ SLQSELTAVR TDILRHKYRE AATITSLQNN NNNFNDTTTT  180
SVSDHAALAA AILLPPPLPP PHPPRPPRLL SSQAAPPVSL PSPSMMVSSS SSSNSSAANS  240
MYNSPPSSAA GCSNSLSSDN NVHYFD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634737.10.0PREDICTED: LOB domain-containing protein 13-like isoform X1
RefseqXP_013659707.10.0PREDICTED: LOB domain-containing protein 13-like isoform X1
RefseqXP_013659708.10.0PREDICTED: LOB domain-containing protein 13-like isoform X1
SwissprotQ9AT611e-129LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0D3C3210.0A0A0D3C321_BRAOL; Uncharacterized protein
STRINGBra021627.1-P1e-132(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-101LOB domain-containing protein 13